PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g28390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 259aa    MW: 29492.7 Da    PI: 5.917
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g28390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-1850103356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+++++ eq+++Le+ Fe+ +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  CA02g28390  50 KKRRLNMEQVKALERSFEMANKLEPERKIQLARALGLQPRQIAIWFQNRRARWK 103
                 456899***********************************************9 PP

2HD-ZIP_I/II132.81.3e-4249139191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+ eqvk+LE+sFe+ +kLeperK +lar+Lglqprq+a+WFqnrRAR+ktkqlEkdye Lkr+yd+lk++n++L+++++eL++el
   CA02g28390  49 EKKRRLNMEQVKALERSFEMANKLEPERKIQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYEILKRHYDSLKADNDALKAQNKELHSEL 139
                  69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.19E-1946107IPR009057Homeodomain-like
SMARTSM003896.1E-1848109IPR001356Homeobox domain
PROSITE profilePS5007116.64949105IPR001356Homeobox domain
PfamPF000461.1E-1550103IPR001356Homeobox domain
CDDcd000866.74E-1750106No hitNo description
Gene3DG3DSA:1.10.10.604.2E-1952112IPR009057Homeodomain-like
PRINTSPR000311.4E-57685IPR000047Helix-turn-helix motif
PROSITE patternPS00027080103IPR017970Homeobox, conserved site
PRINTSPR000311.4E-585101IPR000047Helix-turn-helix motif
PfamPF021839.1E-15105145IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MNIYAGLPSM LMRRSMSFSG AERCDNHQDL RVDDNEMSDD DGSSQLLGEK KRRLNMEQVK  60
ALERSFEMAN KLEPERKIQL ARALGLQPRQ IAIWFQNRRA RWKTKQLEKD YEILKRHYDS  120
LKADNDALKA QNKELHSELL NVKNRESSGG GGTPIMINLN KENEGSWSNN GSDDNNSIDV  180
NLGTATTSGD SPFYSKNVFP ETGPTTLAHF LQSSSRPDLS HCHKIDPTVQ DDQGFCNMFT  240
PVDDQTNFWP WPEQQHFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197105RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624442.11e-146PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X2
TrEMBLK4BBU01e-144K4BBU0_SOLLC; Uncharacterized protein
STRINGSolyc02g087840.2.11e-144(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.14e-62HD-ZIP family protein